MCM6 Blocking Peptide

#
  • Catalog number
    33R-7967
  • Price:

    Please ask

    Ask for price
  • Size
    100 ug
# #
  • Product Type
    Proteins
  • Product Subtype
    Blocking Peptides
  • Research Area
    DNA & RNA
  • Tag Conjugate
    RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE
  • Type1
    Synthetic
  • Form Buffer
    Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Storage
    Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
  • Applications
    WB, IHC
  • Shipping Info
    Blue Ice
  • Test
    You can block the antibody by the specific target amino acid sequence of peptide.
  • Properties
    blocking peptide
  • Description
    Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
#
  • Gene target
    MCM6  
  • Gene symbol
    MCM6
  • Short name
    MCM6 Blocking Peptide
  • Technique
    blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
  • Alternative name
    MCM6 inhibiting short protein sequence
  • Alternative technique
    control, peptides
Gene info
  • Identity
  • Gene
  • Long gene name
    minichromosome maintenance complex component 6
  • Synonyms gene name
    • minichromosome maintenance deficient (mis5, S. pombe) 6
    • MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe) (S. cerevisiae)
    • minichromosome maintenance deficient 6 homolog (S. cerevisiae)
  • Synonyms
  • Synonyms name
  • Locus
  • Discovery year
    1996-06-14
  • Entrez gene record
  • RefSeq identity
  • Classification
    • minichromosome maintenance 2-7 complex
    • MCM family
  • VEGA ID
Similar products
Filters
Contact
Chat with gentaur.com employee